PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC07G07180.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 441aa    MW: 47970.8 Da    PI: 6.2257
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC07G07180.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.52.3e-16108154148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT eEde l + v+ +G + W+ Ia+ ++ gR +kqc++rw ++l
  OPUNC07G07180.1 108 KGGWTREEDEVLRQMVRHHGDRKWTEIAKSLP-GRIGKQCRERWTNHL 154
                      688*****************************.************996 PP

2Myb_DNA-binding52.71e-16162202345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       WT+eEd  l++a++ +G+  W++Ia++++ gR+++ +k++w+
  OPUNC07G07180.1 162 IWTEEEDRMLIKAHQTYGNS-WSAIAKRLP-GRSENTIKNHWN 202
                      6*****************99.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.829103158IPR017930Myb domain
SuperFamilySSF466896.24E-31105201IPR009057Homeodomain-like
SMARTSM007178.4E-16107156IPR001005SANT/Myb domain
PfamPF002492.5E-15108154IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.7E-25110159IPR009057Homeodomain-like
CDDcd001671.13E-15111154No hitNo description
SMARTSM007175.2E-17159207IPR001005SANT/Myb domain
PROSITE profilePS5129417.471159209IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-22160206IPR009057Homeodomain-like
CDDcd001672.61E-14163205No hitNo description
PfamPF002491.3E-15163202IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 441 aa     Download sequence    Send to blast
MAVAGNSFLN QDLVKAADGV PDRHFASSSY VGAYYTNTCG APITVGVPNL GCLVSSIGMA  60
PSSSLMPEEG LATASYNSVA TFLVDAAMVP QQQQTQAASS NDNPGLVKGG WTREEDEVLR  120
QMVRHHGDRK WTEIAKSLPG RIGKQCRERW TNHLHPDIKK DIWTEEEDRM LIKAHQTYGN  180
SWSAIAKRLP GRSENTIKNH WNATKRSLNS KRRLRKKNSK QAAPGQPSLL EDYIRSCQHP  240
LTSETTLPPS VPPVPFDISM YGTSGLIGAS PTPSAVQAPG ISTPPGLVMF LDLLNQAIPH  300
PPQPETMDLI NMTPEVSHLN TSGYCLQLDA GGNLHYGRLP APAPVQPHRI STQEVHETPH  360
LSLYYPLSSF AESHTDGTME FDHQLSIPDG GHYGEEAGPS SVGAGGNANS MDDNDVVQMA  420
SNHFMMPSED EGILDLARWI N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-431042103110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126150.0CP012615.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 7 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645903.10.0PREDICTED: transcription factor RAX1-like
TrEMBLA0A0E0LIK40.0A0A0E0LIK4_ORYPU; Uncharacterized protein
STRINGLOC_Os07g12130.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.12e-48myb domain protein 98